SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022732 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022732
Domain Number 1 Region: 132-369
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-40
Family Regulator of chromosome condensation RCC1 0.0079
Further Details:      
 
Domain Number 2 Region: 768-873
Classification Level Classification E-value
Superfamily POZ domain 7.42e-21
Family BTB/POZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 28-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.8e-19
Family Ankyrin repeat 0.00096
Further Details:      
 
Domain Number 4 Region: 545-647
Classification Level Classification E-value
Superfamily POZ domain 2.16e-17
Family BTB/POZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022732   Gene: ENSFCAG00000023674   Transcript: ENSFCAT00000026111
Sequence length 1359
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:76282433:76361631:-1 gene:ENSFCAG00000023674 transcript:ENSFCAT00000026111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSIPDCTSKCRSLKHALDVLSVVTKGNENQIKAFLSSYCYNAATIKDAFGRNALHLVS
SCGKKGVLDWLIEKGVDLLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYIQDKEGL
SALDLVMKDRPTHVVFKTTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGVYIK
QIIFCLYFSSEYLWSKRDYWYICHLLQGALQRIERYDKMTVIIPRLVEGLSGHNCSQVAA
AKDHTVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQMQAKYLKGRTVIGVAAGRFHT
VLWTREAVYTMGLNGGQLGYLPDPNGEKYVTAPRQVSALHHKDITLSLVAASDGATVCVT
TRGDIYLLTDYQCKKMASKQLNLKKVLVSGGRMEYKVDPENLKENGGQKICILAMDGAGR
VFCWRSVSSSLKQCRWAYPRQVFISDIALNRKDILFVTQDGEGFKGKWFEEKRKNSEKKA
EILSNLHNSSSDVSCVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSL
YEIPAVSSSSFFEEFGKLLRETDETDNIHDVTFQVGNRIFPAHKYILAVHSDFFQKLFLS
DGTTLDFADVYRKDEDSAGCHLFVIEKVHPDLFEYLLQFIYTDTCDFLLHGFTPRINLNK
KPEEYQGALNSHSNKMNCHEDNQKSAFEVYRSNQAHTVNEKQKSKPKSSNKGKSIGEDDP
VRMLQNVAKKFGFSNLSSRLDGVRFENGKINVIEKKTGNKSKLNQKKCSFLCDVTMKSVD
GKEFPCHKCVLCARLEYFHSMLSSSWIEASTCTALEMPIHSDILKVILDYLYTDEAVVIK
ESQNVDFICSVLVVADQLLITRLKGICEVALTEKLTLKNAAMLLEFAAMYNAEQLKLSCL
QFIGLNMAALLEARSLDVLSDGVLKDLSVFYRKMIPAMDRRVITPYQDGPDISYLEVEDG
DIFLKEDINTEQNYSESMFKKAKTRAKKKTRKRSDSSGGYNLSDVIQSPPSTGLLKSGKT
NSVESLPELLTSDSEGSYAGVGSPRDLHSPDFTAGFQSDKIEGKIKPYLNGTPPAYSRED
LKPWEKSPILNISAPQTIPSNKIDTTSSSSWVAGSFSPVSPPVMDLRTIMQIEENRQKCG
ATPKTNLGKMISHGVKLSQKQRKMIAMTTKENNSGTSSMETALTAPSKTPKPVNAWASSL
HSVSSKSFRDFLVEEKKSITGHSSGDHVKKVCFKGIENSQSPKVERCSTHGTPGLEGNHI
SDLPLLDSPKANPWLSSSLTAPSMVAPVTFASIVEEELQQEAALIRSREKPLALIQIEEH
AIQDLLVFYEAFGNPDEFVIIERTPQGPLAVPMWNKHGC
Download sequence
Identical sequences ENSFCAP00000022732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]