SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022792 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022792
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily L domain-like 6.46e-49
Family Internalin LRR domain 0.025
Further Details:      
 
Domain Number 2 Region: 1194-1284
Classification Level Classification E-value
Superfamily PDZ domain-like 3.46e-21
Family PDZ domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022792   Gene: ENSFCAG00000024125   Transcript: ENSFCAT00000032344
Sequence length 1287
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:133575946:133638262:1 gene:ENSFCAG00000024125 transcript:ENSFCAT00000032344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLKEFWMDGNRLTFIPGFIGSLKQLTY
LDVSKNNIEMIEEGISACENLQDLLLSSNSLQQLPETIGSLKNVTTLKIDENQLMYLPDS
IGGLASIEELDCSFNEVEALPSSVGQLTNIRTFAADHNYLQQLPPEIGSWKNITVLFLHS
NKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETD
SETQKMVLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFDCDEDKDEREAP
PREGNLKRYPTPYPDELKNMVKTVQTIVHRLKDEETYEDSGKDLKPHEDQQVVNNDMGVK
TSESTTPVRIKADEREKYMIGNSPQKTSESEAEISPGSLPVTANTKASENLKHIVNHDDV
FEESEELSSDEEMKMAEMRPPLIESSINQPKVVALSNNKKDDTKDTDSLSDEVTHNSNQN
NSNCSSPSRMSDSVSLNTDSSQDTSLCSPMKQTHIGGINSKIRQEDENFNSLLQNGDILN
HSTEENYQVHDKKDFNLPEYDLNIEEQLVLIEKGVDSTATSDESHKLDHINMNLNKLVTN
DTFQPEIVERSKTQDIVLGTDFLSINAKGEAEHLENGNKYPNLECVNKTNGHPEDTPQSP
RRTEPHDTDSSVDMGISKSTEDLSPQRSGPIGSVVKSHSITNMETGGLKIYDIVSDNGPQ
QPSTTVKVTSTVDGKNIVRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPE
EPNIVRGSTISGPQSTPQIYGPPQYNIQYSSSAAVKDTMWHSKQNPQIDHVSFPPQRLPR
SESTENHGYAKHSANMNFSNHNNVRASTGYHLHQRMGPGRHGEVWAISPNERLIPGATRT
TIQRQSSVSSTASVNLGESGPTRRAQIPEGDYLSYRELHSVGRTPVMSGSQRPLSARTYS
IDGPNASRPQSARPSISEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKSKVP
HDWREQVLRHIEAKKLEKSMLSRSFNSNFTAVSNFHYGSSRDLHGSQGSLALSVADGRGS
GGHIFRHPQTSCPGDPCQDDLFISGQPNYSSATLSHKDVPPDSLIKMPLSNGQMGQTLRP
QANYSQIHHPLPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELARQEIRVR
VEKDPELGFSISGGVGGRGNPFRPEDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFIN
IEHGQAVSLLKTFQNTVELIIVREVSS
Download sequence
Identical sequences XP_019690579.1.62641 ENSFCAP00000022792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]