SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022864 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022864
Domain Number 1 Region: 183-275
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.58e-24
Family UBX domain 0.0000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022864   Gene: ENSFCAG00000026418   Transcript: ENSFCAT00000030499
Sequence length 276
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:26809230:26838119:1 gene:ENSFCAG00000026418 transcript:ENSFCAT00000030499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRGVVGIFLFSALPLLCLELRRGIPDLGVKDLILLCGRIFLLLALLTLIISVTTSWLN
SFKSSQVYLKEEEEKNEKRQKLVRKKQQEAQGEKVSRYIENVLKPHQEMKLRKLEERFYQ
MTGETWKLSNGHKLGGDEELVLENGSQTSFETSNSREAAKRRNLPKPLTKISPSAEQPTQ
KEVLDLPEEPPETADEVVAVALRCPSGRVLKRRFFKSCSSQVLFHWMMKIGYHISLYSLS
TSFPRRPLEVEEGWSLQDIGITMDTVLNVEEKDQSN
Download sequence
Identical sequences XP_003984701.1.62641 XP_014918164.1.86478 ENSFCAP00000022864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]