SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000022920 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000022920
Domain Number 1 Region: 68-216
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.98e-46
Family Dual specificity phosphatase-like 0.00000243
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000022920
Domain Number - Region: 20-47
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0201
Family Cell cycle control phosphatase, catalytic domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000022920   Gene: ENSFCAG00000023097   Transcript: ENSFCAT00000031695
Sequence length 271
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:176819463:176822465:1 gene:ENSFCAG00000023097 transcript:ENSFCAT00000031695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQRAPKTGTLGALGPAMVMEXVFFLKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDS
AESGCSSCSTPLYDQGGPVEILPFLYLGSAYHASRKDMLDALGITALINVSANCPNHFEG
HYQYKSIPVEDNHKADISSWFNEAIDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRT
NRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRSTSTT
TVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Download sequence
Identical sequences ENSFCAP00000022920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]