SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023017 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023017
Domain Number 1 Region: 187-335
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.9e-45
Family Dual specificity phosphatase-like 0.00000344
Further Details:      
 
Domain Number 2 Region: 3-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.74e-24
Family Cell cycle control phosphatase, catalytic domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023017   Gene: ENSFCAG00000028649   Transcript: ENSFCAT00000032051
Sequence length 394
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:25563814:25579555:-1 gene:ENSFCAG00000028649 transcript:ENSFCAT00000032051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVEELREMDCSVLKRLMNREENGGGAGGSGSHGAFGLLSGGKCLLLDCRPFLAHSAGY
IRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALATIPPAVPPSTAESLD
VGCGSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAVEAASPSGPLRERGKATPTP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC
Download sequence
Identical sequences M3X8R5
ENSFCAP00000023017 XP_003984695.1.62641 9685.ENSFCAP00000007866 ENSFCAP00000007866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]