SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023082 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023082
Domain Number 1 Region: 246-354
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-25
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 100-243
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000614
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023082
Domain Number - Region: 53-90
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00129
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023082   Gene: ENSFCAG00000029412   Transcript: ENSFCAT00000023818
Sequence length 432
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:138244778:138261559:-1 gene:ENSFCAG00000029412 transcript:ENSFCAT00000023818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKRAEQSLQAAIKTLRRSIGRQLFSIQVAGTEYAMAQWPAKAPEGPGACSTGQVLQDGK
CVACGPGTHFSGEPGQCVPCAPGTYQDGDGXXXXXXXYQDGDGQLSCTPCPSSDGLGLAG
ARNVSECGGQCSPGFFSPDGFRPCQACPVGTYQPEPGRTGCFPCGGGILTKHEGTASFQD
CEARVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQ
HCGGELGDYTGYIESPNYPGDYPANTECVWHISPPPKRRILIVVPEIFLPVEDECGDVLV
MRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQ
LIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLL
RSKVSRFLRPYK
Download sequence
Identical sequences ENSFCAP00000023082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]