SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023107 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023107
Domain Number 1 Region: 240-525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000292
Further Details:      
 
Domain Number 2 Region: 36-211
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.01e-35
Family CRAL/TRIO domain 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023107
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00183
Family CRAL/TRIO N-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023107   Gene: ENSFCAG00000025880   Transcript: ENSFCAT00000027603
Sequence length 542
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:32942827:32987975:1 gene:ENSFCAG00000025880 transcript:ENSFCAT00000027603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIAL
FTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYTNFELDLGKKV
LNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECL
PENLGGYVKIDLATWNFQFLPQMNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQEL
MDYVSTRQKRGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSG
YTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRK
CGQYWPLERDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDY
GVPSSAASLIDFLRVVRNQQRLAVSSMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDIC
LAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEREGMVPSSHNLLAME
GQ
Download sequence
Identical sequences M3X905
ENSFCAP00000023107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]