SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023129 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023129
Domain Number 1 Region: 118-207
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-20
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 412-458
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000301
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023129   Gene: ENSFCAG00000025253   Transcript: ENSFCAT00000025609
Sequence length 463
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:216979103:217037386:-1 gene:ENSFCAG00000025253 transcript:ENSFCAT00000025609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSNPDGLPDYALNSGLVKRLKSALDARDEERVSHLVCAEVRHVDVVMELDERPLGPAAPH
PTTTLVTGDLSRLELLMNEFFQDANVVFEIKKDEMEWQVKSPATFGLSGLWTLEYKRELT
TPLCIAAARGHTACVRHLLSRGADPDASPGGQGALHEACLGGHTACAQLLLQHGADPDLL
SAEGLAPLHLCRTAASLSCRHSLLSSYFHHLQRVGPTPTPTPTPVCHNLIFSPQLSLDSH
SLGTGRPNSGPFSQGRPRSLLAGVICDPGRRGPEEGALLLREGSSSWEGGQCGEASLAPA
VAGSHLTFCRDLHFQGSGTLDGSSPYSQPPPGTGGLFLIPSKWLAVQAQSLRSSVNIWGE
IFKKVLKTCAPAPTVIETLFNSYPQLRVSESWREVIPEEVFQMHQAFYRSLFALAHTPRC
LQHLCRCAIRKLLGKKCFHLAPLLPLPKSLQNYLLLEPEGVLY
Download sequence
Identical sequences ENSFCAP00000023129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]