SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023130 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023130
Domain Number 1 Region: 346-486
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-40
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 2 Region: 634-777
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-38
Family C-type lectin domain 0.000000358
Further Details:      
 
Domain Number 3 Region: 785-921
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-37
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 4 Region: 1217-1356
Classification Level Classification E-value
Superfamily C-type lectin-like 4.3e-35
Family C-type lectin domain 0.00019
Further Details:      
 
Domain Number 5 Region: 928-1050
Classification Level Classification E-value
Superfamily C-type lectin-like 2.06e-32
Family C-type lectin domain 0.00098
Further Details:      
 
Domain Number 6 Region: 19-149
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.55e-32
Family Cysteine rich domain 0.000001
Further Details:      
 
Domain Number 7 Region: 496-634
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-31
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 8 Region: 226-341
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-30
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 9 Region: 1087-1213
Classification Level Classification E-value
Superfamily C-type lectin-like 9.96e-28
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 149-207
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-20
Family Fibronectin type II module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023130   Gene: ENSFCAG00000031929   Transcript: ENSFCAT00000025979
Sequence length 1453
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:16338089:16421869:1 gene:ENSFCAG00000031929 transcript:ENSFCAT00000025979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGAMRLALPPVSLSLTDTRQFLIYNEDHKRCVEALSPSAVQTAVCNQDNEAQKFRWVSD
SRIMSVAFKLCLGVPSKTDWVAVTLYACDPKSEFQKWECKNDTLLGIKGEDLFNYGNKQE
KNVMLYKGSGLWSRWKIYGTTDDLCARGYEDMYTLLGNANGATCAFPFKFENKWYADCTS
AGRSDGWLWCGTTPDYDTDKLFGYCPLKFEGSESLWNKDPLTGISYQINSKSALTWHQAR
RSCQQQSAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGGSPFRYLNWL
PGSPSTEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTNCPS
QWWPYAGHCYKIYREEKKIQRDALTACRKEGGDLASIHSIEEFDFIFSQLGYEPDDELWI
GLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRACERPLDY
ICKTKSQTQPSGTVEVESGCRKGWKRHGFYCYLIGHTLSTFAEANQTCVNEKAYLTTVED
RYEQAFLTSLVGLRPERYFWTGLSDVQNKGTFQWTIEEKVQFTHWNSDMPGRKAGCVAMR
TGVAGGLWDVLRCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEEWGASSKTSLCFKLFA
KGKHEKKTWFESRDFCKALGGDLASINNKEEQQAIWRLIAATGTYHELFWLGLTYGSPSE
GFVWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDSGMSWNDINCEHLNNWICQIQKGQT
PKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCRRNFGDLVSIQSESKK
KFLWKYVNRNDAQPAYFIGLLISLDKKFIWMDGSKVDYVSWATGEPNFANDDENCVTMYS
NSGFWNDINCGYPNAFICQRHNSSINATVIPTVPAVPGGCKEGWNFYNNKCFKIFGFVEE
ERKNWQEARKACIGFGGNLVSIRNDKEQAFLTYHMKDSKFNAWIGLNDVNSEHTFLWTDG
RGVHYTNWGKGYPGGRRSSLSYEDTDCVVTISGTSTERGPTMKGGLEMREGIAQTQTSPN
SSLPGSPTTVPTDGFIKYGESNYSLMKLKLQWQEAENYCKLHTSLIASILDPYSNAFAFM
QIQKVNEPVWIALNSNLTNNEYAWTDKWRMRYTNWAADEPRLKSACVYMDLDGSWKTAYC
NESFYFLCKRSDEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTRNWGQASLECL
RMGSSLVSIESAAESSFLSYRVEPLQSKTNFWIGLFRNVEGMWMWINNNPVSFVNWNTGD
PSGERNDCVALSAASGFWNNIHCSSYKGYICKRPKKVVDAEPTHALITTKADPRKMDPSK
PASNMAGVVVIVVLLIVTGAGLAAYFFYKKRRVHLPQENTFENTLYFNSRLSPGTSDTKD
LVGNIEQNEHAGI
Download sequence
Identical sequences ENSFCAP00000023130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]