SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023235 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000023235
Domain Number - Region: 275-306
Classification Level Classification E-value
Superfamily Kringle-like 0.0981
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023235   Gene: ENSFCAG00000030765   Transcript: ENSFCAT00000023038
Sequence length 463
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:154110358:154165914:-1 gene:ENSFCAG00000030765 transcript:ENSFCAT00000023038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYQAQGPVILPQSNLDDRETLVSEHKHKGKTCRQSTAVFNVVNSIIGSGIIGLPYSMKQ
AGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQFLYP
FIAMISYNIITGDTLSKVFQRIPGVDPANLFIGRHFIIVLSTAAFTLPLSLYRDIAKLGK
ISLLSTVLTTLILGIVMARVVSLSPYIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNCFL
VYGSLEDPTVAKWSRIIHISTLASVLISILFSTCGYLTFTGYTQGDLFENYCRNDDLVTF
GRFCYGVTVILTYPIECFVTREVVANVFFGGNLSLVFHIIVTVVIITIAMLVSLLIDCLG
IVLELNGVLCAAPLIFIIPSACYLKLSEEPRTHSDKIMACVMLPVGAVVMVVGFVMAITN
PQDCTHGQEMFYCFPDNFSLTNISGSHFQLTTQPSILNTSIFQ
Download sequence
Identical sequences M3X9D3
ENSFCAP00000023235 XP_006935387.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]