SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023348 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023348
Domain Number 1 Region: 307-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 728-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 671-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 559-616
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 3-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 615-672
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 769-821
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.71e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 252-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-20
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 11 Region: 522-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000384
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 12 Region: 438-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000432
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 354-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000583
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023348   Gene: ENSFCAG00000022439   Transcript: ENSFCAT00000030623
Sequence length 827
Comment pep:novel chromosome:Felis_catus_6.2:E2:5256906:5275398:-1 gene:ENSFCAG00000022439 transcript:ENSFCAT00000030623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSQVLLTFRDVAIEFSQEEWECLDPAQRALYREVMLENYRNLVSLGVDKVRPDVGICP
NISVRSVIKELSTKEDINKEELFQTLMLERHKRNDIKGLGFREVQQNTHEFESHYGYNET
NYKGVTAAHNHSFTGRRDQQHNISWNVFPLKQDVSVRKSTSQSYKCEKSYKSYLLKLENN
ITCAGNKYIKCFENGIGLRFQSHLTDLQKFQTEEKIHACYQVERLINSSSASPLQRIPSN
INISICSKSRKFLIHPPLLTHQKPHNNEEPYKCNDCGKAFRGSSNLTNHQRIHSGQKPYK
CNDCDKSFNRISHLTRHQRIHTGEKPYKCNVCGKVYSQHSNLTIHQRVHTGEKPYKCEEC
GKAFTEFAKLTRHQRIHTREKPYKCNICGKGYSQNSNLSRHQKVHTGEKPYKCNECGKAF
SEYSSLTRHKRIHSGEKPYKCNECGKTFRGSSNLTLHQRIHSGQRPYKCNECDKSFNCIS
HLTRHQRIHTGEKPYKCDVCGKVCSQYSNLVIHQRVHTGEKPYKCNECGKAFMEHSSLTQ
HKRIHSGEKPYKCEECGKAFTQFAKLTRHQRIHTREKPYKCNICGKGCSQNLNLAQHQKI
HMGEKPYKCNECGKAFSEYSSLTRHKQIHSGEKPYKCNDCGKTFRGSSNLTNHQRTHSGR
RPYKCNECDKSFNCISHLTRHQRIHTGEKPYKCDVCGKVCSQYSNLIIHQRVHTGEKPYK
CNECGKAFMEGSSLTQHKRIHSGEKPYKCKECGKAFSQSSNLVIHQMIHTGEKPYKCNEC
GKAFNVCSSLVRHRRIHTGEKPYKCNECGKSFTQFANLTRHEKMHTE
Download sequence
Identical sequences A0A2I2V4E6
ENSFCAP00000023348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]