SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023411 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023411
Domain Number 1 Region: 29-107
Classification Level Classification E-value
Superfamily Homeodomain-like 2.22e-23
Family Homeodomain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023411   Gene: ENSFCAG00000028938   Transcript: ENSFCAT00000025503
Sequence length 116
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:119167717:119171257:-1 gene:ENSFCAG00000028938 transcript:ENSFCAT00000025503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSYRRGRKKRVPYTKV
QLKELEREYATNKFITKDKRRRISATTNLSERQVTIWFQNRRVKEKKVINKLKTTS
Download sequence
Identical sequences ENSFCAP00000023411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]