SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023501 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023501
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-37
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-241,386-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.87e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 
Domain Number 3 Region: 747-780
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000321
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 781-810
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000128
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023501   Gene: ENSFCAG00000024810   Transcript: ENSFCAT00000030614
Sequence length 962
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:70614012:70732129:1 gene:ENSFCAG00000024810 transcript:ENSFCAT00000030614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQTQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHALSDFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDYAMNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLYITKELDQWPLERLGSVRRSVGLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWGKNYGENADLSLAKSFISHNYLNLTFPR
KRTPRVDVQTEESDMNKRRRRGFNNLDEPSTFSSRSLRSSQECGSNKEGGNQNKVKSMAS
QLLAKFEENSRNPSLVKQESMRKVFPLNLGGSDTCHFCKKRVYVMERLSAEGHFFHRECF
RCSVCASTLRLAAYAFDSDEGKFFCKSHFIHCKANSQQRKRRAELKQQREEEGTWREQEA
PRRDTPVESSCAAAAIGTPEGSPPGITNSFFRKALSWPLRLPWGLLHIPQSLLNWIRGLL
RAAGLHFRDNAYNYCYTYELLSVGLPLLWVFSEVLASMYRESEESLETIRNWVLRCFPVK
LH
Download sequence
Identical sequences A0A2I2UQ37
ENSFCAP00000023501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]