SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023519 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023519
Domain Number 1 Region: 261-357
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 2 Region: 5-92
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000174
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023519
Domain Number - Region: 599-663
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00168
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023519   Gene: ENSFCAG00000025833   Transcript: ENSFCAT00000029207
Sequence length 2183
Comment pep:novel chromosome:Felis_catus_6.2:E1:12023655:12137649:-1 gene:ENSFCAG00000025833 transcript:ENSFCAT00000029207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTLPQGTINMNQCTDVVDGEARTGQKFSLCILTPEKEHFIRAETKEIISGWLEMLMVY
PRTNKQNQKKKRKVEPPTPQEPGPAKMAVTSSSSSSSIPSAEKVPTTKSTLWQEEMRAKD
QPDGSSLSPAQSPSQSQPPAASTLREPGLESKDEESAMSSDRMDCGRKVRVESGYFSLEK
TKQDLKAEEQQLPPPLSPPSPSTPNNRRSQVIEKFEALDIEKAEHMETNSTAGPSPSSDT
RQGRSEKRAFPRKRPDLLNFKKGWLTKQYEDGQWKKHWFVLADQSLRYYRDSVAEEAADL
DGEIDLSTCYDVTEYPVQRNYGFQIHTKEGEFTLSAMTSGIRRNWIQTIMKHVHPTSAPD
VTSSLPEEKNRSSSSFETCPRPSEKPEVERGEPDPEQKRSRARERRREGRSKTFDWAEFR
PIQQALAQERASATGASDAHPEAEAGELERERARRREERRKRFGMLDTVDGPGTDDTALR
MEVDRSPGLPMTTDLKTQNVHVEIEQRWHQVETTPLREEKQVPIAPLHLSSSEDGSDRLS
THELTSLLEKELEQSQKEASDLLEQNRLLQDQLRVALGREQSAREGYVLQTEVATSPSGA
WQRLHRVNQDLQSELEAQCQRQELVTQQIQSLKRSYGEAKDAIRHHEAEIRSLQARLSNA
AAELAIKEQALAKLKGDLKLEKDKVREQLEERQHSEAALSAQLQASEQKLKGAEALLLEK
TQELRDLELQQALQRDRQREAQRLQGRIADLSQQLSASEQAQRLMEEKLQSNYEALLESC
EKEKQALLQNLKEVEDKARAYEDQLQDHEQQVEVLQKEKLSAKFEGSEVVRQLEERLEMK
EASIHKLAEHVQSLRDERDLIRQRFQELMDRVSLSDGDVAELQEKLRGREADCQSLEHSY
RRVAGQLQSMHTLLKEKEEELKHIKEMHEKVLEKKDQDLNEALVKMVALGSSLEETEMKL
QAKEEILRKFVKESSEDAEEPRSCPEEAEDGVVLSGPQPQAAVAPPAFPHPRLEDEDPGA
VPGEERGDSSPRREESPGTLKSEVPDREGPPQSTTKPDQGVPGVKRQRIRFSTIQCQKYT
HPDGSEKTWTSSTSSDTSQDRSPSEESMSSEATPGSLPAASDSDTYLSIIHSLETKLYIT
EEKLKDVTVKLESQQGQSQEALLALHQQWAGTEARLREQLRASLLQVGALASQLEQERQA
RAKMVENHVGELGDFHVKNSQALACLENCREQLRSLPVASQEETQDAGAGPLVGVEHAPG
SSVQAGSHWPAPADSGAQAQPEEGAFSEVGKATSQPLHRPELSEQEQLKLLSDQIALEAS
LINQIADSLQNTTSDISRVLREISQSGKSPLEPESAAVCPGGPADTWAKKVLVDGEFWSQ
VESLSKHLGTLGGEAAGAAGGGQQSVPQALVPALADATWVRAELSFALQSVRESFHRRLQ
SIQETLQGTQMALQQHKRALGDILGAYRTPDFERVMQQVSEALQLPAGTEDGMQASWDLS
PLGEVLSPQEGAGFQEPFYLSTQSSGALVAIQEELALQLKDKASLLGEISAALTSLPPVE
SVRDCQKLLQASQNLSCNTYLGGLGQYSSLLVQDAIIQAQVCYAACRIRLEYEKELRCYK
ASWQSRGTSCQEHEQAVGALREEYEELLRKQKSEYLEVIAIIERENAELKAKVAQLDHQQ
RCLEEAESKHSENMCALQGRYEEEIRCVVEQLNRAGDTLQAEHSRVLSQLDASVRDRRDM
ERHHVEQMQSLEDKFQLKIKELQTIHEEELRTLQEHYAQSLRCLQEALHHYQGRPPEALP
APGPHRPRDAPQPTGGEADSMTGLRERIQELEAQMDIMREELEHKDLEGNAATLREKYQK
DFENLKATCERGFAAMEETHQKKIEDLQRQHQRELEKLREEKDRLLAEETAATISAIEAM
KNAHREEMERELEKSQRSQISSINSDIEALRRQYLEELQSVQRELEVLSEQYSQKCLENA
HLAQALEAERQALRQCQRENQELNAHNQELNNRLAAEISRLRTLLTGDAGGEAAGSPLTQ
GKDAYELEVLLRVKESEIQYLKQEISSLKDELQTALRDKKYASDKYKDIYTELSIVRAKA
DCDISRLKEQLKAATEALGEKSPENTPVSGYDIMKSKSNPDFLKKDRSCVSRQLRNIRSK
SLKEGLTVQERLKLFESRDLKKD
Download sequence
Identical sequences ENSFCAP00000023519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]