SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023609 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023609
Domain Number 1 Region: 575-663
Classification Level Classification E-value
Superfamily PH domain-like 9.96e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 382-475
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 272-323
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 522-574
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000759
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023609
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00735
Family Ubiquitin-related 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023609   Gene: ENSFCAG00000029660   Transcript: ENSFCAT00000022324
Sequence length 686
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:101938512:102023322:-1 gene:ENSFCAG00000029660 transcript:ENSFCAT00000022324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKKTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKLDDQSEDEALELEGPLITPGSGSIYSS
PGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPVTSPEILAKMFKPQA
LLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKWA
ILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGGK
TSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQM
NLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMA
DSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQPGYIRDL
ITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLI
RMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYI
FLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences ENSFCAP00000023609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]