SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023633 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023633
Domain Number 1 Region: 141-253
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-38
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 58-156
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-24
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 3 Region: 274-388
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000499
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023633   Gene: ENSFCAG00000022311   Transcript: ENSFCAT00000023790
Sequence length 493
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:63547777:63783304:-1 gene:ENSFCAG00000022311 transcript:ENSFCAT00000023790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNLSEDALVLSCEEGAAAYNGIGTATNGSFCRGAGGAQPPDSPAGVRTAFTDLPEQVPES
ISNQKRGVKVLKQELGGLGISIKGGKENKMPILISKIFKGLAADQTQALYVGDAILSVNG
ADLRDATHDEAVQALKRAGKEVLLEVKYMREATPYVKKGSPVSEIGWETPPPESPRLGGG
SSDPLSSQPFSFHRDRKSIPLKMCYVTRSMASADPENRQLEIHSPDAKHTVILRSKDSAT
AQAWFSAIHSNVSDLLTQVIAEVREQLGKTGIAGSREIRHLGWLADKVPGESEKQWKPAL
VVLTEKDLLIYDSMPRRKEAWFSPVHTYPLLATRLVHSGPGKGSPQAGVDLSFATRTGTR
QGIETHVFRAETGRDLSHWTRSIVQGCHNSAELVTEVTTACTYKNQACCLTIHYENGFSI
TTEPQEGAFPKTILQSPYEKLKMSSDDGIRMLYLDFGGKDGEIQLDLHSCPKPIVFIIHS
FLSAKITRLGLVA
Download sequence
Identical sequences ENSFCAP00000023633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]