SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023680 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023680
Domain Number 1 Region: 49-136
Classification Level Classification E-value
Superfamily Virus ectodomain 3.11e-16
Family Virus ectodomain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023680   Gene: ENSFCAG00000031768   Transcript: ENSFCAT00000023252
Sequence length 149
Comment pep:novel chromosome:Felis_catus_6.2:A3:78031405:78031898:1 gene:ENSFCAG00000031768 transcript:ENSFCAT00000023252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CILGTIHPSFFLLPLARREYLGIQVYGDRETQRPPEHIIQYYPWAEGGSATALPFMPNCI
IRLQTVVEIITNETARALNLLAKQQTKMHNAVYQNRLTLDYLLAFEGGVRGKFNLRKCHL
QIEDEGKVIEEITDRVRKVAYVPVQTWKC
Download sequence
Identical sequences ENSFCAP00000023680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]