SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023733 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023733
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-37
Family Third domain of FERM 0.00043
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-27
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 3 Region: 5-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-18
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023733   Gene: ENSFCAG00000029922   Transcript: ENSFCAT00000032238
Sequence length 705
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:107770682:107796394:-1 gene:ENSFCAG00000029922 transcript:ENSFCAT00000032238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFHVRVSLSQSGPSLLSEDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLEIL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNSTAL
MVSHILQSELGDFHEETDKKHLAQTRYLPNQDCLESKIMHFHQKHAGRSPAESDILLLDI
ARKLDMYGIRPHPASDGEGMQIHLAVAHMGVVVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHSNILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPRTLLCSKGSSFR
YSSGRTQRQLLEYGKKGRLRSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYG
GGYYRTANGVRASEPVLDGRRRSSAAEVTFAAAPEPSKPEADPALLHQSQSSSSFPFLYT
DPDPRDYFEGRSPLSSFQPSCKFADNHMSTPAGLTSEVSPARRLTYTDVPYIPCTGQQVN
IMPPQVFFYVDRPPQVPRRSPILAEERERPDSSPGPTATKPAKRSPRNVRMKSFQQDFEE
LQEAMAGTSGRSNINIDLEAEDPNLEDAFACNIQEQTPKRSQSQSDMKTIRFPFGSEFRP
LGPCPTLSRKADFFPYMFAEQELPTVLMHQGASERYVASESSDSESEILKSDYYSLYGKG
IRSPMARIRLSSGSLQLDEEDEDVSFSTPTAEDRTLLKPCNYFLA
Download sequence
Identical sequences ENSFCAP00000023733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]