SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023786 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023786
Domain Number 1 Region: 4137-4295
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-30
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 2 Region: 3963-4080
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 4377-4512
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 3478-3637
Classification Level Classification E-value
Superfamily Spectrin repeat 6.54e-25
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 5 Region: 2936-3092
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 3719-3859
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-23
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 3809-3960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-23
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 8 Region: 4507-4623
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-21
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 9 Region: 1698-1857
Classification Level Classification E-value
Superfamily Spectrin repeat 5.38e-21
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 10 Region: 4870-4952
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.09e-20
Family GAS2 domain 0.0006
Further Details:      
 
Domain Number 11 Region: 4293-4407
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-20
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 3371-3528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-19
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 13 Region: 2499-2653
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-19
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 14 Region: 2166-2294
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-19
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 15 Region: 2712-2872
Classification Level Classification E-value
Superfamily Spectrin repeat 4.53e-18
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 16 Region: 3087-3204
Classification Level Classification E-value
Superfamily Spectrin repeat 4.17e-17
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 17 Region: 376-478
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-16
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 18 Region: 4781-4861
Classification Level Classification E-value
Superfamily EF-hand 6.99e-16
Family Polcalcin 0.044
Further Details:      
 
Domain Number 19 Region: 911-1039,1066-1094
Classification Level Classification E-value
Superfamily Spectrin repeat 7.28e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 20 Region: 3154-3304
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000131
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 21 Region: 2387-2509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000106
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 22 Region: 1475-1584
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000173
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 23 Region: 3636-3748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000082
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 24 Region: 4633-4704,4735-4764
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000847
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 25 Region: 1606-1712
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000225
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 26 Region: 1915-2035
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000594
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 27 Region: 2076-2183
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000023
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 28 Region: 283-375
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000038
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 29 Region: 451-558,679-699
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000417
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 30 Region: 2298-2400
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000267
Family Spectrin repeat 0.024
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023786
Domain Number - Region: 1230-1342
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000733
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 705-846
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00497
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023786   Gene: ENSFCAG00000028438   Transcript: ENSFCAT00000026668
Sequence length 5177
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:56376371:56569030:-1 gene:ENSFCAG00000028438 transcript:ENSFCAT00000026668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSSYSYRSSDSVFSNTTSTRTSLDSNENFLSVNCGPTLINSCISFGNESFDGHRLEML
QQIANRVQRDSVICEDKLILARNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVI
DVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRMLTTEQTKLMISGITQSL
NSGFAQTLNPSLNSGLTQGLTPSLTPSSVTSGLSSGLTSRLTPSVTPAYTPGFPSGGLVP
SFSSGVEANSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRT
EWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYA
KLLNTSRNQERHLDTLHNFVTRATNELIWLNEKEEEEVAYDWSERNNNIARKKDYHAELM
RELDQKEENIKSVQEIAEQLLSENHPARLTIEAYRAAMQTQWSWVLQLCQCVEQHVKENT
AYFEFFNDAKEATDYLKNLKDAIQRKYSCDRSSSIHKLEDLVQESMEEKEELLQYKSTVA
SLMGRAKTIIQLKPRNPDCPLKTSIPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVI
SPTGNEAMVPSVCFTVPPPNKEAVDFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINE
IDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCK
QYYQELLKSAEREEQEESVYNLYISEVRNIRLRLESCEDRLIRQIRTPLERDDLHESVFR
ITEQEKLKKELERLKDDLGTITNKCEEFFSQAATSASVPTLRSELGVVIQNMNQVYSMSS
TYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEAVIADKNNIENLISTLKQWRSEVDEK
REVFHALEDELQKAKAISDEMFKTYKERDLDFDWHKEKADQLVERWQNIHVQIDNRLRDL
EGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQ
SKMDECQKYAEQYSTTVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRT
RYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNITKTLRDDEK
AGKSPFSKQKISSEEISTKKEQLSEALQTMQLFLAKHGDKMTDEERNELEKQVKSLQESY
NSFFSESLKQLQESQTLGDTKVEEKIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFV
IGDGTVELKEYQSKQEELQKDMQGSAQALAEIVKNTENFLKENGEKLSQEDKALIEQKLN
EAKLKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDK
DSERAGMRQRQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVGTTEENLNQQYQ
KVKAQHEKIVSQHQAVLMATQSAQALLEKQGHYLSPEEKEKLQKNMKELKTHYETALAES
EKKMKLTHSLQEELEKFDADYSEFEHWLQQSEQELENLEAGADDLSGLMTKLKRQKSFSE
DVISHKGDLRYITISGNRVLEAAKSCSRRSGSSKADQDNIDTSATHREVQSKLDHATDRF
RSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLSGLQACEVTASKHLSEPIAVDPKNLQRQ
LEETKALQGQISNQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYDELSKSV
NERNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLKEQGQVPLNSAALQDVISKNIMLEQ
DIAGRQSSINAMNEKVKKFMETSDPSTASSLQAKMKDLSARFSEASHKHKEKLAKMEELK
TKVELFENLSEKLQTFLETKTQALTDTDVPGKDVSELSQYMQESTSEFLEHKKDLEVLHS
LLKEISSHGLPGDKALVFEKTNNLSKKFKEMEHTIKQKKEAVSSCQEQMDAFQVLVKSLK
SWIEETTERVPIVQPSFGAEDLGKSLEETKKLQEKWSSKTPEIQKVNNSGISLCNLISAV
TTPAKAIAAVKSGMCFTYIRGETHFILFYFLLSGLTSIKKDMTDISHGYEDLGLLLKDKI
SELNSKLSKLQKAQEESSAMMQWLQKMNKTATKWHQAPTPTDAEAVKTQVEQNKSFEAEL
KQNVNKVQELKDKLTELLEENPDTPEAPKWKQMLTEIDSKWQELNQLTVDRQQKLEESSN
NLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFDTRKPQYEQL
TAAGQSILSRPGEHPSFHGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIIKSTQYQSLL
RRLSDKLSDLDNKLITSAAVSTHPDAMNQQLEAAQKMKQELEQEMKQIKVAQALCEDLSA
LVKEEYLKAELSRQLEGIIKSFKDIEQKTENHVQHLQSACASSHQFQQMSRDFQAWLDTK
KEEQNKCPPISAKLDVLESLIKDQKDFSKTLSAQSNIYEKTIAEGENLLLKTQGSEKAAL
QLQLNSIKTNWDGFNKQVKEREDRVKDSLEKALKYREHVETLRPWIDKCQNNLEEIKFCL
DPAETENSVAKLQSLQKEMNQHLGMVELLNNAANSLLSVCEVDKEAVTDENKSLIQKVDM
VTEQLHSKKFSLENMAQKFKEFQEVSKEAKRQVQCAKEQLDVYDSLGPQAYSNKYLTVLQ
TQQKTLQTLKHQVDLVKGLAQDLVVEASDSKGTSDVLLQAEALAQEHSALSQQVDERCSF
LETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDVETLQKQKEDIKAFLKKLEALI
ASNDNANKTCKRMLAMEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTVERLEE
FYSKLKEFSTLLQKAEEHEESQGPVGMETETINQQLNVFKVFQKEEIEPLQVKQQDVNWL
GQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDALESLL
SWMADTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIAATAEP
ADKAKILKQLSLLDSRWEALLSKAETRNRQLEGISVVAQQFHETLEPLNEWLTTIEKKLA
NCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMVQSKLD
SSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQDYSPEG
LWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARYKDITK
LSTDVAKTLEQALQLARRLHSTREELCTWLDKVEVELLSYETQVLTGEAASQAQARQKEL
KKEAKDSKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNDRYRLVSDTITQKVEEIDA
AILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQLQKKFTMEILRHKDII
DELVKSGHKIMTTCSEEEKQSMKKKLDKVLKNYDAICQINSERYLQLERAQSLVNQFWET
YEELWPWLTETQRIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKTGPQLL
ELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIV
ERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKKRGEEMIARSEGTDKDISA
KAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTTKDTQDFIRDLE
DPGIDPSVVKQQQEAAEAIKEEIDGLQEELDIVVNLGSELIAACGEPDKPIVKKSIDELN
SAWDSLNKAWKDRVDKLEEAMQAAVQYQDGLQAIFDWVDIAGGKLASMSPIGTDLETVKQ
QIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDSLDERI
INRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKHHVLQN
DVLAHQSTVEAVNKAGNDLIASSAGEEASNLQNKLEILNQRWQNVLEKTEQRKQQLDGAL
RQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAREQLNAHLEICAAFDVKEETYKS
LMQKGQQMLARCPKSAETIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEFHNSLQD
FINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGTHLKYFS
QKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWLEESEKS
LDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADDNLKLDD
MLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAEDQPVHGD
IDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELSTRWETV
CALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGALPDDEDALRTLIDQHK
EFMKKLEEKRAALNKATSMGDAVLAMCHPDSITTIKHWITIIRARFEEVLAWAKQHQQRL
ASALAGLIAKQELLEALLAWLQWAETTLSDKDKEVIPQEIEEVKALIAEHQTFMEEMTRK
QPDVDKVTKTYKRRAADPASLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIETKNPRVN
LLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKSRVMDFF
RRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNK
DAYKPVTDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLRLVRILR
STVMVRVGGGWMALDEFLVKNDPCRAKGRTNMELREKFILADGASQGMAAFRPRGRRSRP
SSRGASPNRSTSVSSQAGQAASPQVPATSTPKILHPLTRNYGKPWLTNSKMSTPCKPAEC
SDFSVPSAEGTPIQGSKLRLPGYLSGKGFHSGDDSGLITTAAARVRTQFADPKKTPSRPG
SRAGSKAGSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIP
TPQRKSPASKLDKSSKR
Download sequence
Identical sequences ENSFCAP00000023786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]