SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023799 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023799
Domain Number 1 Region: 317-557
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-53
Family Ankyrin repeat 0.00000113
Further Details:      
 
Domain Number 2 Region: 7-38
Classification Level Classification E-value
Superfamily Notch domain 0.0000000863
Family Notch domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023799   Gene: ENSFCAG00000028789   Transcript: ENSFCAT00000025599
Sequence length 557
Comment pep:novel chromosome:Felis_catus_6.2:B2:33731511:33737355:-1 gene:ENSFCAG00000028789 transcript:ENSFCAT00000025599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RARACTPAYDQYCRDHFHNEHCEKGCNTAECGWDGGDCRPKDGDSEWGPSLALLVVLSPP
ALDQQLLALARVLSLTLRVGLWVRKDSDGKDMVYPYPGAQAEEELVGTLDPSHQEFVVVM
GVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEHLLPGPLLAAHPRAGTAPPTNQL
PWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPRTQPTPRRRRPPLG
EDSIGLKALKPEAEVDEDGVVMCSGTKEGEEVGQIPKAEEMASPSKCQLCPLRGDCQELP
QAAMLTPPQESEMDVPDVDTRGPDGVTALMSAVCCGGVESRTFQGSWLGSPEPWEPLLGG
GACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREV
CQLLLRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAA
AVNNARAARSLLQAGADKDAQDGREQTPLFLAAREGAVEVAQLLLGLGAARGLRDHAGLA
PGDIARQRNHWDLLTLL
Download sequence
Identical sequences ENSFCAP00000023799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]