SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023884 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023884
Domain Number 1 Region: 104-131,175-252
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000401
Family Glutathione S-transferase (GST), C-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023884
Domain Number - Region: 43-121
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0179
Family Glutathione S-transferase (GST), N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023884   Gene: ENSFCAG00000030099   Transcript: ENSFCAT00000022656
Sequence length 267
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:164432134:164495918:1 gene:ENSFCAG00000030099 transcript:ENSFCAT00000022656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVAEAFVSQIAAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPVKVXXX
XXXXSFSSTGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLDEVQKAEMKAYMELVNN
MLLTAELYLQWCDEATVGEITHARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLD
QVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYS
NLLAFCRRIEQHYFEDRGKGSSSIRSS
Download sequence
Identical sequences ENSFCAP00000023884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]