SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023918 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023918
Domain Number 1 Region: 89-176
Classification Level Classification E-value
Superfamily SAND domain-like 4.36e-30
Family SAND domain 0.00000974
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023918
Domain Number - Region: 248-345
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023918   Gene: ENSFCAG00000031273   Transcript: ENSFCAT00000030311
Sequence length 540
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:651565:669371:1 gene:ENSFCAG00000031273 transcript:ENSFCAT00000030311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDTAVDGSGVEEVKTVLVTTNLAPHGGDLAEDSMETENAAAA
AAAAFTASSQLKEAVLVKVAEEEEGLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQY
DEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKI
DLSGARVSLSSPTSAEYIPLTPATADVNGSPATITIETCEDPGDWTTAIADDTFSFWRGL
KDAGLLDEVIHEFHQELMETMKGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLAS
HKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTXXXXXTPVSLPPPA
KRPRLARATSGPAAIASQVLTQSAQIALSPGVPVSQLTGVPLGKVVSALPSPALGKGPTQ
AAPAGSPASPLLGGYTVLASSGATFPSTVEIHPDASSLTVLSTAAMQDGSTVVKVVSPLQ
LLTLPGLGPTLQNVAQVSPGGSTIVTVPTGAVESAVAASGPEEHTATIEVAAMAEGREHK
Download sequence
Identical sequences ENSFCAP00000023918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]