SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023936 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023936
Domain Number 1 Region: 201-348
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.39e-42
Family Dual specificity phosphatase-like 0.000000204
Further Details:      
 
Domain Number 2 Region: 3-149
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.31e-32
Family Cell cycle control phosphatase, catalytic domain 0.000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023936   Gene: ENSFCAG00000029747   Transcript: ENSFCAT00000022619
Sequence length 381
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:113729407:113734130:-1 gene:ENSFCAG00000029747 transcript:ENSFCAT00000022619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRAPTQ
QLYFTTPSNQNVYQAGSLQST
Download sequence
Identical sequences M3XBD2
XP_003989146.1.62641 XP_007085666.1.5354 XP_019301940.1.44245 ENSFCAP00000023936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]