SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000023996 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000023996
Domain Number 1 Region: 481-571
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.58e-19
Family Canonical RBD 0.00000482
Further Details:      
 
Domain Number 2 Region: 390-474
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-16
Family Canonical RBD 0.00000943
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000023996
Domain Number - Region: 289-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000238
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number - Region: 802-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00169
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000023996   Gene: ENSFCAG00000021911   Transcript: ENSFCAT00000031420
Sequence length 848
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:116170723:116190778:1 gene:ENSFCAG00000021911 transcript:ENSFCAT00000031420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSFQQSSLGRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGM
SSSLNQQGAHSALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSAR
DLDELSRYPEDKITPENLPQILLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEE
KRHFRRDSFDDRGPSLNPVLDYDHGSRSQESGYYDRMDYEDDRLRDGERCRDDFFGETSH
NYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIEDFHGLLPKGYPHLCSICDLPVH
SNKEWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTNPAPGILGPPPP
SFHLGGPAVGPRGNLGAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVEP
FGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPE
GKPDQKFDQKQELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQAFIEMET
REDAMAMVDHCLKKALWFQGRCVKVDLSEKYKKLVLRIPNRGIDLLKKDKSRKRSYSPDG
KESPSDKKSKIDGSQKTESTTEGKEQEEKSGEDGEKDTKDDQAEQEPNMLLESEDELLVD
EEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAVKKDGNASASAAAKKKLKKVDK
IEELDQENEAALENGIKNEENTEPSAESAENADDPNKDTSENADGQSDENKEDYTIPDEY
RIGPYQPNVPVGIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAE
ERRQKKEA
Download sequence
Identical sequences ENSFCAP00000023996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]