SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024017 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024017
Domain Number 1 Region: 118-497
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.45e-101
Family Phosphonoacetate hydrolase 0.019
Further Details:      
 
Domain Number 2 Region: 588-832
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.29e-24
Family DNA/RNA non-specific endonuclease 0.017
Further Details:      
 
Domain Number 3 Region: 25-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000889
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 71-112
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000641
Family Somatomedin B domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024017   Gene: ENSFCAG00000029427   Transcript: ENSFCAT00000028644
Sequence length 845
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:121111349:121152607:1 gene:ENSFCAG00000029427 transcript:ENSFCAT00000028644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNCRCDVACVDLGNCCLDYQETC
IEPEHIWTCSKFRCGEKRLPRSLCSCSDDCRDKGDCCVNYSSVCRGEKSWVEETCENINE
PKCPAGFEAPPTLLFSLDGFRAEYLHTWGGLLPVISRLKNCGTYTRNMRPVYPTKTFPNH
YSIVTGLYPESHGIIDNKIYDPKMNAYFALKSKEKFNPEWYKGEPIWITAKYQGLKSGTF
FWPGSDVEINGIFPDIYKIYNSSVPFEERILAVLKWLQLPKDERPHFYTLYLEEPDSSGH
SYGPVSSEVIRALQRVDNMVGMLMDGLKELNLHQCLNLILVSDHGMEQGSCKKYVYLNKY
LGDVKNIKIVYGPAARLRPSDVPDKYFSFNYEDLARNLSCREPNQHFKPYLKHFLPKRLH
FAKNDRIEPLTFYLDPQWQLALNPAESKHCGIGFHGSDNIFSNMQALFIGYGPGFKHSIE
VDSFESIEVYNLMCDLLNLSPAPNNGTHGSLNHLLKHPVYTPTHPKEAHPLAQCPFTRTP
RHNLDCSCDPSVLPVVDFEIQLNLTVAEEKVIKRGTVPYGRPRVLQRDSTVCLLYQHRFV
SAYSHDILMPLWTSYTVDRNDSFSTEDFSNCLHQDLRISLNPVHKCSFYKNNAELSYGFL
YPPQLNKGSSQLYSEALLNTNIVPMYQSFQVIWHYFHGTLLHRYAEERNGVNVVSGPVFD
SDYDGCYDSSETLKQNSRRIRNREILIPTHFFIVLTSCKNTFQTPSQCGDLDTLAFILPH
RTDNSESCMHGKQDSSWVEELLKLHRARIADVEHITGLSFYQERKEPISDILKLKTQLPT
FNEED
Download sequence
Identical sequences ENSFCAP00000024017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]