SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024097 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024097
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000000602
Family Single-domain sulfurtransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024097   Gene: ENSFCAG00000026591   Transcript: ENSFCAT00000029364
Sequence length 68
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:91934717:91935618:1 gene:ENSFCAG00000026591 transcript:ENSFCAT00000029364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPKDFKEKYNEVKPSKSDSLVFSCLAGVRSKKAVDTAVSLGFNSVQHYAGGWKEWVTYE
FSEKKKGN
Download sequence
Identical sequences ENSFCAP00000024097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]