SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024105 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024105
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 242-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.01e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-20
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 148-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-17
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024105   Gene: ENSFCAG00000028514   Transcript: ENSFCAT00000022565
Sequence length 438
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:149460029:149474070:-1 gene:ENSFCAG00000028514 transcript:ENSFCAT00000022565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQTTWPQEPVTFEDVAVYFTQNQWASLDPMQRALYREVMLENYTNMASLAFPFPKPVLV
SHLERGEAPWGPDPWEAEVLRGICPGGESRIKNEEPAGKREASEEAEWHRMPGGGLLRDV
SQHFDFKSKATWQTFSLNPNLILRGGMKFYECKECGKIFRYNSKLIRHQMSHTGEKPFKC
KECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLSSNTALTQHQRIHTGEKPYECKECG
KAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVHQRIHTGEKPYQCKECGKAFT
QKIASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPVEKKAVKVLGPSLRSPQCP
SSALSAVPLQGPCSAPAVAVPSLTFPHAVLVPTSGPLFMLLPASGMPSSPVQIVRVFQGL
PPPVKPSPVILTPSPHPS
Download sequence
Identical sequences XP_006936574.1.62641 XP_006936575.1.62641 XP_006936576.1.62641 XP_006936577.1.62641 ENSFCAP00000024105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]