SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024340 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024340
Domain Number 1 Region: 735-924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.4e-61
Family Nucleotide and nucleoside kinases 0.000000055
Further Details:      
 
Domain Number 2 Region: 556-670,729-763
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-31
Family SH3-domain 0.0000555
Further Details:      
 
Domain Number 3 Region: 456-553
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-31
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 4 Region: 207-312
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-29
Family PDZ domain 0.000025
Further Details:      
 
Domain Number 5 Region: 313-407
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-26
Family PDZ domain 0.000044
Further Details:      
 
Domain Number 6 Region: 4-63
Classification Level Classification E-value
Superfamily L27 domain 1.41e-21
Family L27 domain 0.0000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024340   Gene: ENSFCAG00000026503   Transcript: ENSFCAT00000024278
Sequence length 927
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:72236923:72511284:-1 gene:ENSFCAG00000026503 transcript:ENSFCAT00000024278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTL
LDNPKCIDRSKQSEPIQPVNTWEISSLPSTTVTSETLPSSLSPSVEKYRYQDEDTPPQEH
ISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKPTEAVPPSSPTVPVIPVLP
VPAENTVILPTIPQANPPPVLVNTDSLETSSYVNGTDADYEYEEITLERGNSGLGFSIAG
GTDNPHIGDDSSIFITKIIAGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAG
SIVRLYVKRRKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAH
KDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDIT
NSSSQPVDNHVSPSSYLGHTPASPARYSPVSKAVLGDDEITREPRKVVLHRGSTGLGFNI
VGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRTASHEQAAAALKNAGQAVT
IVAQYRPEEYSRFEAKIHDLREQMMNSSISSGSGSLRTSQKRSLYVRALFDYDKTKDSGL
PSQGLNFKFGDILHVINASDDEWWQARQVTPDGESDEVGVIPSKRRVEKKERARLKTVKF
NSKTRGDKGQSFNDKRKKNLFSRKFPFYKNKDQSEQETSDADQHITSNASDSESSYRGQE
EYVLSYEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDG
RDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKR
LQIAQLYPISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTL
EDIYNQVKQIIEEQSGPYIWVPAKEKL
Download sequence
Identical sequences A0A2I2TZZ7
XP_006936228.1.62641 XP_007091033.1.5354 XP_014929265.1.86478 XP_019304297.1.44245 ENSFCAP00000024340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]