SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024446 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024446
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-26
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024446
Domain Number - Region: 40-120
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 0.0547
Family Dimeric isocitrate & isopropylmalate dehydrogenases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024446   Gene: ENSFCAG00000025995   Transcript: ENSFCAT00000031625
Sequence length 130
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:16358231:16371669:-1 gene:ENSFCAG00000025995 transcript:ENSFCAT00000031625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQGSVTFRDVAIDFSQEEWEFLDSAQRDLYRDVMWENYSNFISLEPSISKPDVITLLDE
GKEPWMVIREGTRRHYPDLESRYRTNTLSPEKDIYEIYSFQWEIMERIKSYSLQDSLFRN
DWECKGKIEG
Download sequence
Identical sequences ENSFCAP00000024446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]