SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024458 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024458
Domain Number 1 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-27
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024458   Gene: ENSFCAG00000031877   Transcript: ENSFCAT00000022636
Sequence length 103
Comment pep:novel chromosome:Felis_catus_6.2:A2:83609784:83618306:1 gene:ENSFCAG00000031877 transcript:ENSFCAT00000022636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKSQIEQKSQGSVSFKDVTVGFTQEEWQCLDSSQRSLYRDVMLENYSHLVSVGSCATKP
EVIFRLEQGEEPWISEEEFPSQSLPGGLIHTAPMNIRTFIIFP
Download sequence
Identical sequences XP_011285525.1.62641 XP_019669700.1.62641 XP_019669701.1.62641 XP_019669702.1.62641 ENSFCAP00000024458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]