SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024510 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024510
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000112
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024510
Domain Number - Region: 184-224
Classification Level Classification E-value
Superfamily Ribosomal protein L4 0.085
Family Ribosomal protein L4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024510   Gene: ENSFCAG00000003749   Transcript: ENSFCAT00000003750
Sequence length 250
Comment pep:novel chromosome:Felis_catus_6.2:E2:91032:92498:-1 gene:ENSFCAG00000003749 transcript:ENSFCAT00000003750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFEDVAMYLSQEEWELLDAAHVMLENFALVSSLGLSASRPWVVLQLERGEEPWVLSGTV
VTPARNAQRKPSPGEWGLRGCELGANQWPGFCPPFPCFPGHFHLLPPTFTGTCERGKSSV
GWQGTSLSQEKKSTGVSVIYWERLLLGPGSGEANVSLRLTSPLRTPEDSPPREKALMNRP
MPDKQLRPYGGQKPFGQDGPGRGCTKIPEFEASLTSGEREKGGTSLKPHGLPASQEPPTW
DQLGKALHTG
Download sequence
Identical sequences ENSFCAP00000024510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]