SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024519 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024519
Domain Number 1 Region: 375-574
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.72e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024519   Gene: ENSFCAG00000027540   Transcript: ENSFCAT00000024280
Sequence length 576
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:139353527:139375822:1 gene:ENSFCAG00000027540 transcript:ENSFCAT00000024280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHLFLGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDNNGNPKNGDL
SSIEGILKNDRIDCSMKTTKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLEHHEQPALPAQEQLRPKPQLEQENIKSS
SPSSDFAKDEVIGMVTRAHKDTFMYNQEQRENSADTMQPQRERIPKSMEQYNLNHDHCGS
GLSSHFPCSESQQHLNGQYKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVSIDGF
SQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
NSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences ENSFCAP00000024519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]