SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024544 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024544
Domain Number 1 Region: 140-313,366-559
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.8e-91
Family Phosphonoacetate hydrolase 0.012
Further Details:      
 
Domain Number 2 Region: 636-902
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.18e-35
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 46-92
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000418
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 94-134
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000301
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024544   Gene: ENSFCAG00000010937   Transcript: ENSFCAT00000025741
Sequence length 904
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:62693439:62773868:-1 gene:ENSFCAG00000010937 transcript:ENSFCAT00000025741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISLFTFAVGVNICLGFTANRIKRAEGWDEGPPTVLSDSPWTNTSGSCKGRCFELQEIGP
PDCRCDNLCKSYSSCCHDFDELCLKTAGGWECTKDRCGEVRNEDNACHCSEDCLARGDCC
TNYQVVCKGESHWVDDDCEEIKAPECPAGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEK
LRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFN
HRWWGGQPLWITATKQGVKAGTFFWSVVIPHERRILTILQWLTLPDDERPSVYAFYSEQP
DFSGHKYGPFGPEESSYGSPLTPAKRPKRKVTPKRRQERPVAPPKKRRRKLHRMDHYAAE
TRQDKMTNPLREIDKTVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTN
VDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLTCKKPDQHFKPYMKQHLPKRLHYANNR
RIEDIHLLVDRRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFVGYGPTFKYKT
KVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTMPEEVTRPNYPGIMYL
QSDFDLGCNCDDKVEPKNKLDELNKRLHIKGSTEERHLLYGRPAVLYRTRYDILYHTDFE
SGYSEIFLMPLWTSYTVSKQAEVSGIPEHLTNCVRPDVRVSPSFSQSCLAYKNDKQMSYG
FLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGVNVISGPIF
DYDYDGLHDTQDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPLSVSSFILPHR
PDNEESCNSSEDESKWVEELIKMHTARVRDIEHLTSLDFFRKTSRSYPEILTLKTYLHTY
ESEI
Download sequence
Identical sequences ENSFCAP00000024544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]