SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024566 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000024566
Domain Number - Region: 11-105
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024566   Gene: ENSFCAG00000024282   Transcript: ENSFCAT00000025349
Sequence length 253
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:62284343:62297756:1 gene:ENSFCAG00000024282 transcript:ENSFCAT00000025349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCTIEKALADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHR
PRSTLVMGIQQENRQIRELQQENKELRTSLEEHQSALELIMSKYREQMFRLLMASKKDDP
GIITKLKEQHSKIDMVHRNSSEGFFLDASRHIFEASQHGLERRHLEANQNELQAHVDQIT
EMAAVMRKAIEIDEQQGCKEQERIFQLEQENKGLREILQITRESFLNLRKDDVSESSSLS
ALVTNSDLSLRKS
Download sequence
Identical sequences D2H5Z7 J9NZK8 M3XD60
ENSAMEP00000012307 ENSCAFP00000016514 ENSAMEP00000012307 ENSCAFP00000038728 XP_002917156.1.58354 XP_003988563.1.62641 XP_005636767.1.84170 XP_005636768.1.84170 XP_006933639.1.62641 XP_007075691.1.5354 XP_007075692.1.5354 XP_011220496.1.58354 XP_014920688.1.86478 XP_014920689.1.86478 XP_019307828.1.44245 XP_019307829.1.44245 ENSFCAP00000024566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]