SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024574 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024574
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-37
Family Dual specificity phosphatase-like 0.0000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024574   Gene: ENSFCAG00000031413   Transcript: ENSFCAT00000025633
Sequence length 138
Comment pep:novel chromosome:Felis_catus_6.2:D2:37922351:37924322:-1 gene:ENSFCAG00000031413 transcript:ENSFCAT00000025633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATANNRFELWKLGITHVLNAAHGGLYCQGSPDFYGSSVSYLGVPAHDLPNFDISAYFSSA
ADFIHRALSTPGAKVLVHCVVGVSRSATLVLAYLMLHQQLSLREAVITVRQHRWVFPNRG
FLHQLCQLDQQLRGAGRS
Download sequence
Identical sequences ENSFCAP00000024574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]