SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024585 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024585
Domain Number 1 Region: 368-401
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000374
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024585
Domain Number - Region: 90-136
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00248
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 48-56
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00366
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024585   Gene: ENSFCAG00000030184   Transcript: ENSFCAT00000021932
Sequence length 412
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:98418236:98419474:1 gene:ENSFCAG00000030184 transcript:ENSFCAT00000021932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRNKKLLKTKRRKGGRGGQDPGLHPHRSEAAPGRSPPTPTLTLGPDCPPPPPPPPPNGPS
SSSSSCSSSSSSSSSSRSGQRGQYIPNLAERRRDDLSEEINNLREKVMKQSEENNNLQNQ
VQKLTEENTSLREQVEPAPQDEEDDLELRGAAAAAAPPTPIEEECPDDLPEKFDGNPDML
VPFMAQCQLFMEKSTRDFSVDRVRVCFVTSMMTGRAARWASAKLERSHYLMHNYPAFMTE
MKHVFEDPQRREAAKRKIRRLRQGMGSVIDYSNAFQMIAQDLDWNEPALIDQYHEGLSDH
IQAELSRLEVAKSLSALIGQCIHIERRLARAAAARKPRSPPRALVLPHITSHHQVDPTEP
VGGARMRLTQEEKERRRKLNLCLYCGNGGHYADNCPAKASKASPAGNSPAPL
Download sequence
Identical sequences ENSFCAP00000024585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]