SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024590 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024590
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-26
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024590   Gene: ENSFCAG00000024160   Transcript: ENSFCAT00000026894
Sequence length 100
Comment pep:novel chromosome:Felis_catus_6.2:B2:2972384:2973314:1 gene:ENSFCAG00000024160 transcript:ENSFCAT00000026894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQESVTFKDVIVDFTQEEWKQLDPVQRDLFRDVTLENYTHLVSIGLQVSKPDVISQLEQG
TEPWVVESGVPGATGGGLFFPLLLDLQALLLGLSNGNSNL
Download sequence
Identical sequences ENSFCAP00000024590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]