SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024629 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024629
Domain Number 1 Region: 181-526,605-629
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.39e-82
Family Myotubularin-like phosphatases 0.000043
Further Details:      
 
Domain Number 2 Region: 24-167
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000971
Family TFIIH domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024629   Gene: ENSFCAG00000025077   Transcript: ENSFCAT00000025658
Sequence length 728
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:213371178:213415355:1 gene:ENSFCAG00000025077 transcript:ENSFCAT00000025658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLNMNLEIHTNEKEVTEKEVTLHLLPGEQLLCEASTVLKYVQEDSCQRGIYGKLVCTD
FKIAFLGDDDSALDNDETQFKNKVIGENDITLHCVDQIYGVFDEKKKTLFGQLKKYPEKL
IIHCKDLRVFHFCLRYTKEEEVKRIVSGIIHHTQAPKLLKRLFLFSYAAAAQNHAATDPR
NHTVMFDTLKDWCWELERTKGSVKYKAVSVNEGYKVCERLPAYFVVPTPLPEEDLSRFQG
HGIPLWCWSCHNGCALLKMSALPKKEQDDGLSQMQKSFLDGIYKTIHRPPYEIVKTEDLS
SNFLSLQDIQTAYSKFKQLFLIDNSTEFWDTDIKWFSLLESSSWLDIIRRCLKKAIEITE
CLEAQNVNVLLLEENASDLCCLVSSLVQVMMDPHCRTRIGFQSLVQKEWIMGGHSFLDRC
NHLRQSDKEEVPVFLLFLDCVWQLVHQHPPAFDFTETYLTVLSDSLYIPIFSTFFFNSPH
QKDNVGRESQDTQSKPLNLLTVWDWSVQFEPKAQMLLKNPLYVEKPKLDKGQRKGTRFKH
QRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLINSSDELHDNFREFYDSWHSK
PTDYHGLLLPHIEGPEIKVWAQRYLRWIPEAQILGGGRAATVSKLLEMMEEVERLQEKID
ARPHGQGALLAEAPLLLRGSARLSALFPFALLQRHPSKPVLPTSGWKALGDEEDLAKRED
EFVDLGDV
Download sequence
Identical sequences A0A2I2V3F2
ENSFCAP00000024629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]