SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024827 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024827
Domain Number 1 Region: 2-208
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.07e-40
Family Ankyrin repeat 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024827
Domain Number - Region: 320-334,404-414
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000107
Family Formin homology 2 domain (FH2 domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024827   Gene: ENSFCAG00000031339   Transcript: ENSFCAT00000026472
Sequence length 703
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:3445110:3475672:1 gene:ENSFCAG00000031339 transcript:ENSFCAT00000026472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQWLLSQGGCGVQDRDNSGATVLHLAARFGHPELVEWLLRHGGGEATATTDTGALALHYA
AAKGDFPSLRLLIGHYPEGVNAQTKNGATPLYLACQEGHLEVTQYLVQECGADPHVRAQD
GMTPLHAAAQMGHCPVIVWLVSFRGGAGPGEGXGVRAGDRVLSTRPPQCCQILVVNGAEL
DVRDRDGYTAADLSDYNGHSHCTRYLRTVENLSVEHRVLSRDPSAELETKQPDSGMSSPD
TTVSVQPLNFDLSSPTSTLSNYDSCSSSHSSIKGRRPPRGLASSRAADIQSYMDMLSPEL
GRPQGKMGRTTPPPPPSFPPPPPPPSTQLPPPPPGYPAPKPPVEPHAADIYVQTKSKLRH
VEKEAFKKEVVNLLPAACLPALGPGLSGSWVLPDLLHSVVGRSRNWQRLPPPQTYLRPEP
QAQPKANHSRAKLSNQFAHRCPRSQGHWVGEGRGNFHSDSTLPSCHLRPGCQSGSPFISV
RPPPPPPEPLPGGATEPALPRDPRPIPARRTGGPGNPAACTPRRPLAMSPGKEVRVLRHR
KSTKSFNMMSPTGDNSELLAEIKAGKSLKPTPQSKGLTTVFSGSGQPISQVGGSTGTPPR
PPXKRQVMVRKLQLKMQEEEEQRRKEEEEEARLASMPAWRRDLLRKKLEEEREQKRKEEE
RQKQEELQREKEQSEKLRTLGYDESKLAPWQRQIILKKGDIAK
Download sequence
Identical sequences ENSFCAP00000024827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]