SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000024995 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000024995
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily PH domain-like 3.47e-35
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000351
Further Details:      
 
Domain Number 2 Region: 365-401
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000628
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000024995
Domain Number - Region: 173-276
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00012
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000024995   Gene: ENSFCAG00000025054   Transcript: ENSFCAT00000030493
Sequence length 405
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:143556729:143614689:1 gene:ENSFCAG00000025054 transcript:ENSFCAT00000030493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYDDTSKKWVPIKAGQQGFSRINIYHNTASNTFRVVGVKLQDQQVVINYSIVKGLKYNQ
ATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNIMNSQEGGPSTQRQVQNGPSPDE
MDIQRRQVMEQTQHQQQRQESLERRTSATGPILPPGHPSSAASAPLSCSGPPPPPPPPVP
PPPAGATPPPPPPLPAGGAQGASHDESSVSGLAAALAGAKLRRVQRPEDASGGSSPSGTS
KSDANRASSGGGGGGLMEEMNKLLAKRRKAASQTDKPADKKEDESQTEELSTSPSPGTRA
ASQPPNSSEAGRKPWERSNSVEKPVSSLLSRTPSVAKSPEAKSPLQAQPHSRMKPVGGVN
DVALDALDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTS
Download sequence
Identical sequences ENSFCAP00000024995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]