SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025007 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025007
Domain Number 1 Region: 6-153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.51e-38
Family G proteins 0.000047
Further Details:      
 
Domain Number 2 Region: 153-192
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000628
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025007   Gene: ENSFCAG00000030517   Transcript: ENSFCAT00000029329
Sequence length 245
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:42487953:42517090:-1 gene:ENSFCAG00000030517 transcript:ENSFCAT00000029329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTIWSPKLLIGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDI
TNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNGMTFFEVS
PLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPV
TIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGSSKGNSLKRSKSIRPPQSPPQNCSRS
NCKIS
Download sequence
Identical sequences ENSFCAP00000025007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]