SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025010 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025010
Domain Number 1 Region: 13-74
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-25
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 2 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 534-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.96e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 6 Region: 576-628
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 274-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-17
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000372
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 172-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000393
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025010   Gene: ENSFCAG00000025947   Transcript: ENSFCAT00000024335
Sequence length 637
Comment pep:novel chromosome:Felis_catus_6.2:A2:6990063:7004975:-1 gene:ENSFCAG00000025947 transcript:ENSFCAT00000024335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEERAAELQKNMTQDSVVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFQNLASLGYP
LHTPYLISQWKQEEDLETVERGPIQGEHQEGFETQLKTRESVTPQDTYGQKISNEQKIVR
FKRNDSSSSILHKNGEYRGIYYQNKNHERHLRSPMVENVHEHSEENRRGPTFDQISHLNI
LKRTTEVKSYECRECKTAFADHLSLKNHIRSHAGSKPYQCKECGKGFHFLACFKKHVKTP
TEGKPYECKECMKAFACSSFFRAHMKIHTGKTNYECKECGKTFSCSSSLTEHKRIHSGDK
PYECRECGKAFSCSSSLSKHKRIHSGDKPYECKECGKAFSSSSHLIIHIRIHTGEKPYEC
KECGKAFSESSKLTVHVRTHTGDKPYKCKECGKAYNCPSSLSIHMRKHTGEKPYECLECG
KAFYLPTSLNTHVKNQSREKPYECKECGKAFSCPSSFRAHVRDHTGKIQYECKECGKAFS
RSSSLTEHLRTHSGEKPYECKECGKAFISSSHLTVHIRTHTGEKPYECKKCGKAFIYPSA
LRIHMRTHTGEKPYECKECGKAFRHSSYLTVHARMHTGEKPFECLECGKAFSCPSSFRRH
VRSHTGEKPYECKECGKAFVCPAYFRRHVKTHSRENT
Download sequence
Identical sequences ENSFCAP00000025010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]