SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025012 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025012
Domain Number 1 Region: 319-472
Classification Level Classification E-value
Superfamily ARM repeat 1.78e-39
Family MIF4G domain-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000025012
Domain Number - Region: 15-24,270-310
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0497
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025012   Gene: ENSFCAG00000025654   Transcript: ENSFCAT00000025015
Sequence length 483
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:186702531:186718023:1 gene:ENSFCAG00000025654 transcript:ENSFCAT00000025015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYAWGVLAGGAGEQPPPLRPPPPPLLSLEGGRMYGAAGPPARSASAPVVRSLRRPPPPAT
GVSFMNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDA
SGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNK
LIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTLNASILNSLYNENL
VKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQSVEHFTKYFTEA
GLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIPEPVVIGIV
WSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCYDNIHFM
KAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAE
EGD
Download sequence
Identical sequences ENSFCAP00000025012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]