SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025049 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025049
Domain Number 1 Region: 124-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-146
Family Myotubularin-like phosphatases 0.0000000331
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 2e-16
Family GRAM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025049   Gene: ENSFCAG00000011961   Transcript: ENSFCAT00000026388
Sequence length 660
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:19554299:19621317:1 gene:ENSFCAG00000011961 transcript:ENSFCAT00000026388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQIYKPVVENVRLVDRISSKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEK
QATAATGCPLLIRCKNFQLLQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPKLDK
EEREQGWMLIDLSEEYKRMGLPNNYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPALSYYYRDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRNSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGVSVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERQELKIQERTYSLWAHLWKNRADYMNPLFRDDHS
QTRGTLRLPTTPCNFLYKFWSGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEEEREALEE
RLEKIQKVQLNHTKVKAKQSEPSKHSGFSTSDNSTANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGECAPSEDSGKDRDSDEAVFLTA
Download sequence
Identical sequences ENSFCAP00000025049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]