SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025066 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025066
Domain Number 1 Region: 564-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 620-676
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 508-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 676-732
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 788-844
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-22
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 7 Region: 732-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 829-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000967
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 10 Region: 454-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000227
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 342-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000363
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 12 Region: 257-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000011
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 13 Region: 223-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000132
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000025066
Domain Number - Region: 298-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00041
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025066   Gene: ENSFCAG00000031825   Transcript: ENSFCAT00000031716
Sequence length 912
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E2:11527961:11560823:1 gene:ENSFCAG00000031825 transcript:ENSFCAT00000031716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFQEPVMFKDVAVVFSEEELGLLGPTQRKLYRDVMLENFRNLVSVGNQPFKPELISQL
EREEKLLMMETESQRDGCLGAKSQHNMESSQAVGLGYISPKEPSSRKTWQQSTGGLTRCQ
DAMKNFQRNISQLQNRGDFPCQVWAGVPVHVPEDENYILTHIEDVSNCIKSQEFPSWRAQ
HSWRKMYLTESHNYQCRCQQILMKNNFCKCDSTSWITPHNDNLGVHRSEKIYSCHDCGEN
LMKVSLLNQDLIKTGQKPYSCNEYRKAFSDDSNSEVYQQLHLEGKTHTYSPCGKGCSYSS
VLHIHQSVHRRDDCVFESSPLQSHQRVHTEEKPYKCGYGENFSQPSSLNTCGLIHTGQTS
YRCNIYEKAFNHSLDLNSIFRIHTKEKPHEYEENGGVFNQSSCLQVYQKIHTGEKLYTDV
EYEKGFLCSSNLNIQHRVHMEEIPYSSEECGNNFSLDSHLQDLQIVHTREQPYKHYACGN
SFSQNSYLQGHQKIHIGEKAYKDCGNGFSWSSKLKDHQRVHTGEKPYKCNACGKGFSHRS
VLNVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCEECGKGFSRNSYLQG
HQRVHTGEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCEECGKGFSWSFNLQIHQRV
HTGEKPYKCGECGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQSVHTGE
RPYICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYK
CEVCTKGFSESSRLQAHQRVHTEGRPYKCEQCGKGFSGFSSLQAHHRVHTGEKPYKCEVC
GKGFSQRSNLQAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHSGDKFYKSEEYGKDY
PSSENPYRNEDL
Download sequence
Identical sequences ENSFCAP00000025066 XP_003997781.2.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]