SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025163 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025163
Domain Number 1 Region: 5-12,304-363
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000000523
Family Formin homology 2 domain (FH2 domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025163   Gene: ENSFCAG00000031096   Transcript: ENSFCAT00000022346
Sequence length 460
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B1:202901731:202904305:1 gene:ENSFCAG00000031096 transcript:ENSFCAT00000022346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPPPPPPPPPPPPFPGAEEEEEEEEEEEEEEEKEREKVAAAAVQRRRKEAPSQVSLPL
STTGREEAVSAREAEGEERQGAESEEMEELGLLRSPRRSQVKLKDEEESLDDEDGEWTEE
VQRLQEQQLRAELLQQYQSLVAERGHYQRYNIYLQHKISEALRKKKGPDAAQVPDKGAEP
EAPGKEQAYLRYLAMLEELRKQRADDLDWYHQELEQLKREGTEERARVEKEWRAFQALKK
QVTVQAMGGSWMRGGRQAALRQVGQIQALEDKKEKEMSAVRLENVQLKQSLAHLETRMRA
QEDLTEGLLLIDFEQLKIENQTFNEKVEERNEELLKLRNKVTRNVQIVTHVKEKLHFVDL
QNACKKSQLLEIEAQVALRRDILTKTKKARDGLRIDNIKLNQKCGLLGKEPLLCDLEEKV
DKAKLLRQRLESLKRHHARLIMSCRGVKQKMREAKAFLPS
Download sequence
Identical sequences ENSFCAP00000025163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]