SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025359 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025359
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Kringle-like 1.47e-31
Family Kringle modules 0.0000144
Further Details:      
 
Domain Number 2 Region: 80-147
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.8e-23
Family Eukaryotic proteases 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025359   Gene: ENSFCAG00000023975   Transcript: ENSFCAT00000025096
Sequence length 177
Comment pep:novel chromosome:Felis_catus_6.2:B2:146212006:146374489:-1 gene:ENSFCAG00000023975 transcript:ENSFCAT00000025096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGNGKGYRGKRATTVSGIPCQEWGAQEPHRHGIFTPVTNPQSGLEKNYCRNPDGDVNGP
WCYTMSPRKLFDYCDVPQCASASFDCGKPQVEPKKCPGRVVGGCVANPHSWPWQVSLRTR
FGQHFCGGTLIAPEWVLTAAHCLERSSRPLFFSQVKEAGRDIFSKRKHDLERNVLVT
Download sequence
Identical sequences ENSFCAP00000025359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]