SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025372 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025372
Domain Number 1 Region: 26-362
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.26e-61
Family WD40-repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 359-405
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000105
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025372   Gene: ENSFCAG00000026080   Transcript: ENSFCAT00000022864
Sequence length 406
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:14601727:14619276:-1 gene:ENSFCAG00000026080 transcript:ENSFCAT00000022864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPVLEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLE
EHFIPKGFEAKSRSSKNDTKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQV
PDISCLILATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTL
RIWDLNKHGKQIQVLSGHLQWVYCCSVSPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGH
QSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQLDPPMDDSDVHISSLRS
VCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQ
FWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
Download sequence
Identical sequences M3XFG1
ENSFCAP00000025372 XP_003994757.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]