SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000025536 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000025536
Domain Number 1 Region: 841-1120
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-72
Family Protein kinases, catalytic subunit 0.00000428
Further Details:      
 
Domain Number 2 Region: 524-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-49
Family Protein kinases, catalytic subunit 0.0000611
Further Details:      
 
Domain Number 3 Region: 371-500
Classification Level Classification E-value
Superfamily SH2 domain 6.26e-18
Family SH2 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 279-386
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-16
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 141-261
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000152
Family Second domain of FERM 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000025536   Gene: ENSFCAG00000028588   Transcript: ENSFCAT00000022254
Sequence length 1133
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:6445743:6522591:-1 gene:ENSFCAG00000028588 transcript:ENSFCAT00000022254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMACLTMTEMEGVSVSPVHQNGDIPGNANSVKQIDPLLQVYLYHSLEKADGEYLKFPTG
EYVAEEICVAASKACGITPVYHSMFALMSETERTWYPPNHVFHVDESTRHNVLYRIRFYF
PYWYCNGSNRTYRHGVSRGAEAPLLDDFVMSYLFAQWRHDFLHGWIKIPVTHETQEECLG
MAVLDMMRLAKEKDQTPLDIYSSISYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIEQF
SHCKATARNLKLKYLINLETLQSAFYTEQFEVKEPGRGPSGEEIFATIVITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVTIKQGNQEGSNESRIVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPMVLENIQSNCHGPILMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERDNVIEYKHCLITKNENGEYNLSGTKKNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKLKTDKSNLLVFRTNGVSDVPTSPTLQRHNNVNQMVFHK
IRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAAS
MMSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSISILWKLEVAKQLAW
AMHFLEEKALIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWV
PPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWTE
LANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNRIGTLGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAEGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQ
ICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIF
WYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLI
ELLKNNGRLPRPDGCPDEIYLIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Download sequence
Identical sequences ENSFCAP00000025536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]