SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000047 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000047
Domain Number 1 Region: 6504-6659
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 59-199
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-19
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 3 Region: 6883-6997
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 6284-6408
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-19
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 1779-1901
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-18
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 6 Region: 5419-5561
Classification Level Classification E-value
Superfamily Spectrin repeat 5.47e-17
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 5533-5674
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-17
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 8 Region: 2953-3110
Classification Level Classification E-value
Superfamily Spectrin repeat 1.28e-16
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 9 Region: 5876-6007
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 1563-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000103
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 11 Region: 905-1034
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000259
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 12 Region: 2335-2451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000055
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 13 Region: 3508-3651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000804
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 5208-5348
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000017
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 15 Region: 2735-2891
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000327
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 16 Region: 2207-2328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000494
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 17 Region: 6074-6225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000072
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 5803-5910
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000733
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 19 Region: 1123-1249
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000223
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 20 Region: 6959-7106
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000024
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 21 Region: 6412-6522
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000032
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 22 Region: 1277-1394
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000336
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 23 Region: 2013-2145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000537
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 24 Region: 691-846
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000618
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 25 Region: 4378-4514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000104
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 26 Region: 4158-4275
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000262
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 27 Region: 3403-3502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000108
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 28 Region: 364-513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000417
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 29 Region: 1928-2039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000432
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 30 Region: 1477-1575
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000768
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 31 Region: 152-306
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000151
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 3920-4039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000192
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 33 Region: 4038-4134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000105
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 34 Region: 2652-2780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000353
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 35 Region: 5003-5086
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000039
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 36 Region: 4826-4931
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000406
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 37 Region: 1690-1790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000623
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 38 Region: 3323-3433
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000122
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 39 Region: 589-704
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000236
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 40 Region: 2447-2577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000024
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 41 Region: 4524-4638
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000081
Family Spectrin repeat 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000047
Domain Number - Region: 5132-5245
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000403
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number - Region: 3647-3765
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00109
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 3107-3219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00144
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 2564-2669
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0245
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000047   Gene: ENSFCAG00000000049   Transcript: ENSFCAT00000000052
Sequence length 7246
Comment pep:novel chromosome:Felis_catus_6.2:B2:139057412:139332962:-1 gene:ENSFCAG00000000049 transcript:ENSFCAT00000000052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQKSVSEFEDKLADPIKICSSATETYKILQEHMDLCQALEALNSAVTTVSASAQKVANRA
TSSVQEAAALQQRYEETRSRAKERQAVLENLLARWQRLEKELSTFLTWLERCEAIASSPE
MDISADRVKVESELQSIQALQNELVSQASVYSNLLQLKESLFSVASKDDVKMMKLHLEQL
DERWRDLPQIISKRINFLQSVVSEHQQFDELLLSFSVWIKLFLSELQTTSEISITDHQAA
FARHKDHEVEAESKMGDLQRLRDHLAKLGALGRAEDLHLLQGKAEDCFQLFEEASQVVGR
RQLALSQLAEFLQRHASLSGVLHRLRHTVETTDSMNKKQTDLLKKDLNRAIQDAKTLEST
AVSLDGILAKAQYHLKSGSSEQRTSCRSTADHLCFELERIQNLLGTKQSEADALAALKKA
FQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKDKA
KQIAQKDVAFASEVDREINRLEVTWDDTKKLIHENFLFCGIGLLSVDLRWCDRVNCVVKK
HLILINKNCLLIFTILKGSIDLKHLCPQHESVKNEMCNKQKELDNFTSKGKQLLSELKKI
HSSDFNLVKTDMESTVDRWLDVSEKIEENMDRLRASLTIWGDVLSSKDEIDGWSNNSVPQ
LAESISNLNNSVRAEEFLKEFESEVKNKALRLEELHCKVNDLKELTKNPETPPDLQFIEA
DLRQKLEHAKEITEEAKGTLKEFTTQSTQVEKFINDITSWLTKVEEALMNCAQTETWEGL
KKVKEIQKELQSQQSNISSTQDNLNSLCRKYHSIELESLGSAMTGLIKNHEAVSQLCSKT
QASLQDFLEKHFNEESMQEFQEWFSGIKAAAKKSSDRTGDSKVLEAKLHDLQQNILDSIS
DGQSKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCALEL
GSFEDQHRKLNLWIHEMDERLSTENFGESKQHIPEKKNEVHKVEMFLGELLAVRESLDKL
SQRGQLLSEEGHGAGKEGRLCSQLLTNYQNLLRTTKEKLRNCQLALQEHEALEEAVQSMW
SWVKDIQDRLACAESTVGSKDTLEKRLLQIQDILLMKGEGEVKLNMAIGKGEQALRSSNK
QGQKVIQTQLQNLKDVWADIMSSSVRAQSTLESVISKWNDYLEWKNQLEQWMEFVDQKVE
HPLQPQPGLKEKFSLLDHFQSIVSEAEDHAGTLHRLASKSRELYQKTEDESFKETAQEEL
KTQFNDIITVSKEKMRKVEEIVKDHLMYLDAVQEFTDWLHSAKEELHRWSDMSGDSSATQ
KKLSKIKELMDSRGIGASRLSRVESLAPAVRQNTSASGCELVDAEMQALRADWKQWEDSV
LQTRTSLENLVSQMALSEQEFSGQVVQLEQALEQFGALLTTCAQQLALLESKNTDKEIVE
CWRKGQEILDALQKAEPKTEDLKSQLNELCRFSRDLSAYSGKVSGLIKEYNCLCLQASKG
CQTREQILQQRFQRAFKDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENG
QHKLNVMVSKGELLSTLLPKEKADGIQAKVATAKEDWKKFHSNLHQKESALENLKIQMKD
FEVSAEPVQDWLSKTEKLVQESSNRLYDLPAKRREQQKLQSVLEEINCYEPQLNRLREKA
QQLWEGQAASKSFMHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMT
DAVHMLDSYCHPISDKSVLDSRMLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGWP
AIQQQLQSVKDMWASLLSAAIRCKSQLEGALSKWTSYQDDVRQFSSWMDSVEASLNESER
QYAELREKTASLGKAKLLSEEVLSYSSLLEAIELKGAGMTEHYVTQLEFQDLQERYRAIT
ERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQE
LQVHCAEGQVLLNSVLHTREEVIPSGIPQTEDRALESLRQDWQAYQQRLSETRTQFNNVV
NKLRLMEQKYQQVDEWLKTLEDKVSLRAGRQSNRAAKEIQLHQMKKWHEEVIAYKDEVED
VGARAQEMLDENHVSSSMGCQATQLASRYQALLLQVLEQIQFLEEEIQSLEESELSLSSY
SDWYSSTHKNFKNVATKIDRVDKATMGKKMKTLEGLLKDMDKGHSLLKSAREKGERALKY
LEDGEAEMLRKDIHEHVEQLKELTSTVRKEHMTLEKGLLLAKEFSDKYKALTQWISEYQE
ILHTPEEPKMELYEKKAQLSKYKSLQQMVLSHEPSIKSVREKGEALLELVQDVTLKDKMD
KLQSDYQDLCGAGKEHVCSLETKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLMETSSLE
TITQQLAHHKAMMEEIAGFEDRLNNLKSKGDNLISQCADHLQAKLKQNVYAHLQGTKDSY
SAVCSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLKPSQHPPLSRAEAVKQVK
HYRALQEQARTYLDLLCSTCDLSSSSVKTTAKDIQETEQMIEQRLVQAQNLTQGWGEIKH
MKAELWIYLQDADQQLQNMKKRHSELELNIAQNMVSQVKDFVKKLQCKQASVTAITERVN
KLTKKQESPEHKEISHLNDQWLDLCLQANSLCLQREEDLQRTRDYHDRMNVVEEFLEKFT
TEWDNLARSDAESTAVHLEALKKLALALQERKQAVEDLKDQKQKMIEHLNLDDKELVKEQ
TSHLEQRWFQLEDLVKRKLQASVTNLEELNVVRSRFQELMEWAEEQQPNIAEALKQSPPP
DMAQNLLMDHLAICSELETKQMLLKSLIKDADRVMADLGLNERQIIQKALSDAQRHVNCL
SDLVGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCK
SAQASLKTYQNEVTGLWAQGRELMKETTEQEKSEVLGKLQELQSVYDTVLQKCSHRLQEL
EKSLVSRKHFKEDFDKACHWLKQADIITFPEINLMNESAELHAQLAKYQHILEQSPEYEN
LLLTLQRTGQAILPSLNEVDHSYLNEKLNALPLQFNVIVALAKDKFYKVQETILARKEYA
SLIELTTQSLSELEDQFLKMSKVPTDLRVEEAVSLQEGCRALLGEVARLGEAVDELNQKK
ESFRSTGQPWQPDKMLHLVTLYHRLKRQTEQRVGLLEDTSSAYQEHEKMCHQLEKQLQAV
KTEQSKVNEETLPAEEKLKIYHSLAGSLQDSGIVLKRVTVHLEDLVPHLDPSAYEKAKQQ
IQSWQEELKVLTSAIGATVTECESRMVQSIDFQTELSRSLDWLRSVKAELSGPVCLDLSL
QDIQEEIRKTQIHQEEVQSSLRIMNALSNKEKEKFTKAKELLSADFQHTLAELSELDGDV
QEALRTRQAALTQIYSQCQRYYQVFQAANDWLEDAHEMLQLAGNGLDVESVEENLKSHVE
FFSTEDQFHSNLEELQHLVASLDPLIKPTGKEHLAQKMASLEEKSQRIIQDSHAQLDLLQ
RCADQWQNYQKAREEVIELMNEAEKKLSEFSLLKASSSHEAEEKLSEHKALASVVNSFHE
KVVALEDKTSQLEKTGNDASKAAISRSMTTVWQRWTRLRAVAQDQEKILEDAVDEWTSFN
NKVKKATETTDQLQDKLLGGSAEKASKAELLTLLDHHDALVLELEQQQLALGMLRQQALG
MLQDGAPQPPGEEPPTVQEITAMQDRCLNMQEKVKNTGKVVKQELKEREVVETQINSVKS
WVQETKEYLGNPTIEIDAQLEELQLLLTEATNHRQSIEKMAEEQKNKYLGLYSILPSELS
LQLAEVALDLGTIHDQIQDKVREVEQSKAMSQEFSRQIQKIAKDLTTILSKLRAKTDNLQ
QAKIDQKVLGEELDGCNLKLMELDAAVQKFSEQNGQLGKPLAKKVGKLMELHQQTIRQAE
NRLSKLSQAASHLEEYTEMLEFILKWIEKAKVLVHGKIAWNSANQLREQYIFHQTMLEES
EEIPSNLEAMIEKLQCLASIYSTEKMSQQVADLGRESEELRQTIKIRLQNLQDAAKDMKK
FETELKNLQVALEQAQTTLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVHAVQICQSAL
RIPDDVVASLPLCHCALHLQAEASRLQHTAIQQCNIMQEAVVQYEQYEQEMQHLQELIEG
AHREIEDTPAATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLL
TVTEVEGLAEGTEDLDRELLPATSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSP
PACRSPSPVANTDASVNQDIAYYQALSAERLQTDAARIHPSTLPSPEFYELGLEPSATAK
LDDLQRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIEMKLSESLEHGRGP
ESQMAEHQALMDEILMLQEEISELQSSLAEELVSQSPESDPAEQLALQSTLTVLAERMST
IKMMASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDHWLLSTKATLDTALGTAQEP
MDMEAQLVDCQNMLVEIEQKVVALSELSVHNDNLLLEGKAHTKEEAEQLAVKLRTLKGSL
LELQRALHDKQLLMQGTAQEKEESHADLTASQSPGVQEWLAQARTAWAHQRQSSLQQQKQ
ELEQELAEQKSLLRSVASRGEEILTQHSAAETSAGIGEKPDVLSQELGMEGEKSASEDQM
RMKWESLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDGQTQDRSAVTSLL
DGLNQAFEEVSSQGGGTKRQNIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETEAC
LFNQETLAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQR
CHQMKERLQQILNFQNDLKVLCTSLADSKYIILQKLANVFEQPVAEQIEAIQQAEDGLKE
LDAEIIELKKRGDKLQIEQPSMQELSKLQDMYDELMMTIGSWRSSLNQNLALKSQYERAL
QDLADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIINFA
VLQETQFHTELMTQASAVLKRAHKRGVELEYILETWSHLDEDHQALSKQLEVVESSIPSV
GLVEESEERLIDRIALYQHLKSSLHEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGEQ
WLDNTNKVSKELHRLETVLKHWTRYQSESAELIHWLQSAKDRLEFWTQQSVTVPQELEMV
RDHLNAFLEFSKEVDAKSSLKSSVLSIGNQLLRLKKVDTASLRSELSHIDSQWTDLLTNI
PTVQEKLHQLQMDKLPSRHAISELTTWISLMENVIQKDEENIKNSIGYKAIHEYLQKYKG
FKIDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQ
LLEGLLESWSEYENNVQSLKTWYETQENKLKQQHRIGDQASVQSAMKDCQDLEDLIKAKE
KEVEKIEQNGLALIQNKKEEVSGVVMSTLRELNQTWANLDHMVGQFKILLKSVFDQWNNH
KEAFDEINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQEKNLQNFGSITN
QLLKECHPPVTETLTTTLKDVNMRWNNLLEEIAKQLCSSKALLQLWRRYKDYSKQCASTV
QQQEDGASELLKAATNKDIADDEAATWIQDCNDLLKGLGTVKDSLFVLRELGEQLKQQVD
ASAASTIQSDQLSLSQRLCALEQALCKQQTMLQEKKKAGVLDYETFTKSLEALEAWIVEA
EEILQGQDPGHSSDLSTIQQRMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQ
NLNRHWSLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLL
EQQRAHELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRA
QQRRGIIDSQIRQWRRYREMAEKLRKWLVEVSYLPVSALGSVPIPLQQARTLFDEVQFKE
KVFLRQQGSYILTVEAGKQLLLSADSGAEAALQAELAEIQEKWRSASVRLEEQKKKLAFL
LKDWEKCESGIADSLEKLRTFKKKLSPPLPDHHEELHAEQMRCKELENAAGNWTDDLAQL
ALLKDTLCAYISADDISILNERMELLQRQWEELCHQLSLRRQQVSERLNEWAVFSEKNKE
LCEWLTQMESKVSQNGDILIEEMIEKLKKDYQEEIAVAQENKIQLQQMGERLARASHESK
ASEIEYKLGKVNDRWQHLLDLMAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKP
IVYDSCDSDEIQKKLTEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQ
ATRNLDRRWRNICAMSMERRLRIEETWRLWQKFLDDYSRFEDWLKISERTAAFPSSSGVL
YTVAKEELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDN
LQKRVTSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKA
FQQEISLNHNKIEQIISQGEQLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLI
RLPLPDDEHDLSDRELELDDSAALSDLHWRDTSADSMLSPQPSSNPSLSLAQPLRSERSG
RDTPASVDSIPLEWDHDYDLSRDLESAVSRTLPSEDEEVGDDKDFYLRGAVGLSGAPSAL
ESQIRQLDKALDESRFQMQQTENIIRSKTPTGPELDSSYRGYMKLLGECSGSIDSVRRLE
HKLKEEEENFPGFVNLNSTETQTAGVIDRWELIQAQALSKELRMKQNLQKWQQFNSDLNN
IWTWLGETEEELERLQHLELSTDIQAIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQ
TGSEKSQDLQDRLSQMNGRWDRVCSLLDEWRGLLQDALMQCQDFHEMSHGLLLMLENIDR
RKNEIVPIDSNQDAETLQDHHKQLMQIRHELLESQLKVASLQDMSCQLLVNAEGTDCLEA
KEKVHVIGNRLKLLLKEVSRHIKELEKLLDMSSSQQDLSSWSSADELDTSGSVSPTSGRS
TPNRQRTPRGKCSLSQPGPSVNSPHSRSIKGGCDSSLSEPRPARSGRAFLLRVLRAALPL
QLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences ENSFCAP00000000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]